Structure of PDB 8brm Chain Sg |
>8brmSg (length=63) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence] |
PEPINARVIEVLGRTSSRGGITQVKVEFMTGEKRQIIRNVIGPVRKDDIL VLMESEREARRLR |
|
PDB | 8brm Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis. |
Chain | Sg |
Resolution | 3.33 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
Sg |
R15 S18 R19 P44 |
R14 S17 R18 P43 |
|
|
|
|