Structure of PDB 8xt2 Chain Sf

Receptor sequence

>8xt2Sf (length=370) Species: 9606 (Homo sapiens)

VARYPPIVASMTADSKAARLRRIERWQATVHAAESVDEKLRILTKMQFMK
YMVYPQTFALNADRWYQYFTKTVFLSGLPAALRAVACDCLLQEHFYLRRR
RRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYW
VRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIE
IPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHTQFHLLPDKLRRER
LLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAV
ITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDV
KGFNDDVLLQIVHFLLNRPK

3D structure

• PDB: 8xt2 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: Sf
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Sf	A49 S50 T52 A53 D54 S55 K56 A57 R59 R62 W66 R81 K85 M86 Q87 Y94 T97 F98 R160 R162 H164 R165 Y166 R219 G220 H221 R222 R223 R225 K270 P272 F274 Q277 K305 R307 R310 R313	A9 S10 T12 A13 D14 S15 K16 A17 R19 R22 W26 R41 K45 M46 Q47 Y54 T57 F58 R100 R102 H104 R105 Y106 R159 G160 H161 R162 R163 R165 K210 P212 F214 Q217 K245 R247 R250 R253

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006915 apoptotic process
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8xt2, PDBe:8xt2, PDBj:8xt2
• PDBsum: 8xt2
• PubMed: 38942792
• UniProt: Q9NP92|RT30_HUMAN Large ribosomal subunit protein mL65 (Gene Name=MRPS30)