Structure of PDB 8rxh Chain Sf

Receptor sequence
>8rxhSf (length=80) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]
GGKGKKKKKRIFTKPKKPTHRHKLEKMRALKYFKVTENDDGSYKVERTRQ
DCPHPQCGAGVYMAQHKDRQYCGKCHLTYK
3D structure
PDB8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
ChainSf
Resolution2.93 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sf G69 K73 K76 F80 K82 K84 K85 P86 H88 R89 H90 K91 L92 K94 R96 Y100 V129 Y130 A132 H134 R137 Y139 G141 K142 H144 T146 K148 G1 K5 K8 F12 K14 K16 K17 P18 H20 R21 H22 K23 L24 K26 R28 Y32 V61 Y62 A64 H66 R69 Y71 G73 K74 H76 T78 K80
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
Biological Process
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum8rxh
PubMed38722744
UniProtQ4QFK7

[Back to BioLiP]