Structure of PDB 7xnx Chain Sf

Receptor sequence
>7xnxSf (length=61) Species: 9606 (Homo sapiens) [Search protein sequence]
NKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHY
CGKCCLTYCFN
3D structure
PDB7xnx A Dynamic rRNA Ribomethylome Drives Stemness in Acute Myeloid Leukemia.
ChainSf
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sf K92 H93 R95 K97 K99 L100 Y105 F131 A133 H135 R138 Y140 K143 T147 K2 H3 R5 K7 K9 L10 Y15 F41 A43 H45 R48 Y50 K53 T57
BS02 ZN Sf C121 C126 C141 C31 C36 C51
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Feb 17 19:06:34 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7xnx', asym_id = 'Sf', title = 'A Dynamic rRNA Ribomethylome Drives Stemness in Acute Myeloid Leukemia.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7xnx', asym_id='Sf', title='A Dynamic rRNA Ribomethylome Drives Stemness in Acute Myeloid Leukemia.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003677,0003735,0005840,0006412', uniprot = '', pdbid = '7xnx', asym_id = 'Sf'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003735,0005840,0006412', uniprot='', pdbid='7xnx', asym_id='Sf')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>