Structure of PDB 7qgg Chain Sf

Receptor sequence
>7qggSf (length=67) Species: 10116 (Rattus norvegicus) [Search protein sequence]
YTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMGS
HFDRHYCGKCCLTYCFN
3D structure
PDB7qgg Neuronal RNA granules are ribosome complexes stalled at the pre-translocation state.
ChainSf
Resolution2.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sf T86 T87 K89 K90 N91 K92 R95 K99 A101 R118 F131 S134 H135 R138 Y140 G142 K143 T2 T3 K5 K6 N7 K8 R11 K15 A17 R34 F47 S50 H51 R54 Y56 G58 K59
BS02 ZN Sf S123 D124 E125 C126 S39 D40 E41 C42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0008150 biological_process
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qgg, PDBe:7qgg, PDBj:7qgg
PDBsum7qgg
PubMed36038000
UniProtP62982|RS27A_RAT Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=Rps27a)

[Back to BioLiP]