Structure of PDB 8k82 Chain Se

Receptor sequence
>8k82Se (length=60) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVN
GKRRMNPGPS
3D structure
PDB8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainSe
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Se R10 K13 V14 K15 Q17 V21 K23 T24 K28 K31 R33 A34 K36 R37 R42 R43 N46 R55 N57 R9 K12 V13 K14 Q16 V20 K22 T23 K27 K30 R32 A33 K35 R36 R41 R42 N45 R54 N56
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0010494 cytoplasmic stress granule
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k82, PDBe:8k82, PDBj:8k82
PDBsum8k82
PubMed38942792
UniProtP0CX33|RS30A_YEAST Small ribosomal subunit protein eS30A (Gene Name=RPS30A)

[Back to BioLiP]