Structure of PDB 8glp Chain Se

Receptor sequence
>8glpSe (length=50) Species: 9606 (Homo sapiens) [Search protein sequence]
GSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVKGPNANS
3D structure
PDB8glp mRNA decoding in human is kinetically and structurally distinct from bacteria.
ChainSe
Resolution1.67 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Se R82 A83 G84 K85 V86 R87 Q89 T90 V93 K95 Q96 E97 K98 K99 K100 T103 R105 K107 R108 R109 N113 R115 G128 P129 N130 A131 N132 S133 R5 A6 G7 K8 V9 R10 Q12 T13 V16 K18 Q19 E20 K21 K22 K23 T26 R28 K30 R31 R32 N36 R38 G45 P46 N47 A48 N49 S50
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0002227 innate immune response in mucosa
GO:0006412 translation
GO:0019731 antibacterial humoral response
GO:0050830 defense response to Gram-positive bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8glp, PDBe:8glp, PDBj:8glp
PDBsum8glp
PubMed37020024
UniProtP62861|RS30_HUMAN Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein (Gene Name=FAU)

[Back to BioLiP]