Structure of PDB 7z3n Chain Se

Receptor sequence

>7z3nSe (length=40) Species: 759272 (Thermochaetoides thermophila DSM 1495)

GSLARAGKVKSQTPKVEKQEKKKTPKGRAKKRLTYTRRFV

3D structure

• PDB: 7z3n Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.
• Chain: Se
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Se	R10 K13 V21 K23 K28 K31 R37 R43	R5 K8 V16 K18 K23 K26 R32 R38

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Feb 22 02:42:22 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7z3n', asym_id = 'Se', title = 'Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7z3n', asym_id='Se', title='Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7z3n', asym_id = 'Se'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7z3n', asym_id='Se')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>