Structure of PDB 7wtn Chain Se

Receptor sequence
>7wtnSe (length=38) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TEKPKKPKGRAYKRLLYTRRFVNVTLVNGKRRMNPGPS
3D structure
PDB7wtn The nucleoplasmic phase of pre-40S formation prior to nuclear export.
ChainSe
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Se K31 R33 R37 R43 N46 R55 M56 N57 K8 R10 R14 R20 N23 R32 M33 N34
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0010494 cytoplasmic stress granule
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wtn, PDBe:7wtn, PDBj:7wtn
PDBsum7wtn
PubMed36321656
UniProtP0CX33|RS30A_YEAST Small ribosomal subunit protein eS30A (Gene Name=RPS30A)

[Back to BioLiP]