Structure of PDB 8y0u Chain Sd

Receptor sequence
>8y0uSd (length=53) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ENVWFSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFN
KFR
3D structure
PDB8y0u dormant ribosome with STM1
ChainSd
Resolution3.59 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sd E4 V6 W7 H10 P11 R12 Y14 G15 K16 G17 R19 G29 R32 K33 Y34 R40 Q41 C42 E45 K54 F55 R56 E1 V3 W4 H7 P8 R9 Y11 G12 K13 G14 R16 G26 R29 K30 Y31 R37 Q38 C39 E42 K51 F52 R53
BS02 MG Sd T28 G29 T25 G26
BS03 ZN Sd C21 C24 C39 C42 C18 C21 C36 C39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y0u, PDBe:8y0u, PDBj:8y0u
PDBsum8y0u
PubMed38698775
UniProtP41057|RS29A_YEAST Small ribosomal subunit protein uS14A (Gene Name=RPS29A)

[Back to BioLiP]