Structure of PDB 8bsi Chain Sd

Receptor sequence

>8bsiSd (length=98) Species: 5741 (Giardia intestinalis) [Search protein sequence]

PVKRRNNGRSKYNCGHTNIVRCQNCHRCVPKDKVIKRFTIRNIVDNTIAD
DVLNACVIQGFAIPKLYNKVQYCVSCSIHNHIVRVRSREDRKIRTPPK

3D structure

PDB

8bsi Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Sd	P2 V3 K4 R5 R6 N7 N8 G9 R10 S11 K12 Y13 N14 C15 G16 H17 N19 K32 K34 K37 R38 F39 K70 V75 S76 I79 H80 H82 R85 V86 R87 S88 E90 R92 K93 R95 P97	P1 V2 K3 R4 R5 N6 N7 G8 R9 S10 K11 Y12 N13 C14 G15 H16 N18 K31 K33 K36 R37 F38 K69 V74 S75 I78 H79 H81 R84 V85 R86 S87 E89 R91 K92 R94 P96

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links