Structure of PDB 7z3n Chain Sd

Receptor sequence

>7z3nSd (length=52) Species: 759272 (Thermochaetoides thermophila DSM 1495)

ESVWNSRPRTYGKGSRACRVCTHQAGLIRKYGLNICRQCFREKAADIGFV
KY

3D structure

• PDB: 7z3n Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.
• Chain: Sd
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Sd	W7 R10 R12 Y14 K16 C24 R32 K33 R40 Q41 C42 Y55	W4 R7 R9 Y11 K13 C21 R29 K30 R37 Q38 C39 Y52
BS02	ZN	Sd	C21 C24	C18 C21

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Feb 19 04:53:34 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7z3n', asym_id = 'Sd', title = 'Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7z3n', asym_id='Sd', title='Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0008270', uniprot = '', pdbid = '7z3n', asym_id = 'Sd'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008270', uniprot='', pdbid='7z3n', asym_id='Sd')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>