Structure of PDB 3j7r Chain Sd

Receptor sequence
>3j7rSd (length=52) Species: 9823 (Sus scrofa) [Search protein sequence]
GFYWSHPRKFGQGSRSCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFIK
LD
3D structure
PDB3j7r Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.
ChainSd
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sd Y7 W8 S9 H10 P11 R12 K13 F14 Q16 G17 R19 R22 N26 R27 H28 G29 I31 R32 K33 Y34 C39 R40 Q41 R44 K54 L55 D56 Y3 W4 S5 H6 P7 R8 K9 F10 Q12 G13 R15 R18 N22 R23 H24 G25 I27 R28 K29 Y30 C35 R36 Q37 R40 K50 L51 D52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j7r, PDBe:3j7r, PDBj:3j7r
PDBsum3j7r
PubMed24930395
UniProtQ6QAP6|RS29_PIG Small ribosomal subunit protein uS14 (Gene Name=RPS29)

[Back to BioLiP]