Structure of PDB 8rxh Chain Sc

Receptor sequence
>8rxhSc (length=85) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]
GFFDADLSYPTVRTERMKHKRRRLVQGPNSYFMDVSCPRCRQVTVVYSHA
TTSVECKGCSKKLCRPTGGKALLVEGCGYRRKPDH
3D structure
PDB8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
ChainSc
Resolution2.93 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sc F4 D5 T12 V13 R14 R17 M18 H20 K21 R22 R23 Q27 P29 N30 S31 Y48 H50 T52 R66 P67 T68 G69 G70 K71 L73 L74 E76 D85 F3 D4 T11 V12 R13 R16 M17 H19 K20 R21 R22 Q26 P28 N29 S30 Y47 H49 T51 R65 P66 T67 G68 G69 K70 L72 L73 E75 D84
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum8rxh
PubMed38722744
UniProtQ4Q140

[Back to BioLiP]