Structure of PDB 7d5t Chain Sc

Receptor sequence
>7d5tSc (length=80) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
LVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQT
AVTCESCSTILCTPTGGKAKLSEGTSFRRK
3D structure
PDB7d5t Cryo-EM structure of 90S preribosome with inactive Utp24 (state F1)
ChainSc
Resolution6.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sc R17 H19 K20 Q26 S30 F47 H49 Q51 T67 G68 G69 K70 K72 R15 H17 K18 Q24 S28 F45 H47 Q49 T65 G66 G67 K68 K70
BS02 ZN Sc C37 C40 C35 C38
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7d5t, PDBe:7d5t, PDBj:7d5t
PDBsum7d5t
PubMed
UniProtP35997|RS27A_YEAST Small ribosomal subunit protein eS27A (Gene Name=RPS27A)

[Back to BioLiP]