Structure of PDB 6lqp Chain Sc

Receptor sequence
>6lqpSc (length=80) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
LVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQT
AVTCESCSTILCTPTGGKAKLSEGTSFRRK
3D structure
PDB6lqp Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
ChainSc
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sc R17 H19 K20 L21 K22 P28 S30 H49 Q51 P66 T67 G68 G69 K70 R15 H17 K18 L19 K20 P26 S28 H47 Q49 P64 T65 G66 G67 K68
BS02 ZN Sc C37 C40 C59 C35 C38 C57
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lqp, PDBe:6lqp, PDBj:6lqp
PDBsum6lqp
PubMed32943522
UniProtP35997|RS27A_YEAST Small ribosomal subunit protein eS27A (Gene Name=RPS27A)

[Back to BioLiP]