Structure of PDB 8y0u Chain Sb

Receptor sequence
>8y0uSb (length=81) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VLVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQ
TAVTCESCSTILCTPTGGKAKLSEGTSFRRK
3D structure
PDB8y0u dormant ribosome with STM1
ChainSb
Resolution3.59 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sb R17 H19 K20 L21 K22 P28 S30 Q51 G68 G69 K70 K72 R16 H18 K19 L20 K21 P27 S29 Q50 G67 G68 K69 K71
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y0u, PDBe:8y0u, PDBj:8y0u
PDBsum8y0u
PubMed38698775
UniProtP35997|RS27A_YEAST Small ribosomal subunit protein eS27A (Gene Name=RPS27A)

[Back to BioLiP]