Structure of PDB 8ovj Chain Sb

Receptor sequence

>8ovjSb (length=103) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

TTKRRNHGRSKPAHSRGRVKPIHCFNCGRLTPKDKAVGRFVVRRMLDAAS
ARDVAEASPVYGANFPMPRLYMKQRFCIACAIHSRTVRARPVGNRKIRYT
KKV

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Sb	T2 K4 R5 R6 N7 H8 G9 R10 P13 A14 H15 S16 R17 G18 R19 K34 K36 R40 F41 K74 R76 I79 I83 V88 R89 R91 P92 V93 R96 R99 Y100 K102 K103	T1 K3 R4 R5 N6 H7 G8 R9 P12 A13 H14 S15 R16 G17 R18 K33 K35 R39 F40 K73 R75 I78 I82 V87 R88 R90 P91 V92 R95 R98 Y99 K101 K102
BS02	ZN	Sb	C25 C28 C78 C81	C24 C27 C77 C80

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links