Structure of PDB 3j7r Chain Sb

Receptor sequence
>3j7rSb (length=83) Species: 9823 (Sus scrofa) [Search protein sequence]
PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQ
TVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
3D structure
PDB3j7r Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.
ChainSb
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sb R17 H19 K20 K21 K22 Q26 P28 S30 Y31 F32 H49 Q51 T67 G68 G69 K70 R72 R16 H18 K19 K20 K21 Q25 P27 S29 Y30 F31 H48 Q50 T66 G67 G68 K69 R71
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0014069 postsynaptic density
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j7r, PDBe:3j7r, PDBj:3j7r
PDBsum3j7r
PubMed24930395
UniProtA0A4X1W2B6

[Back to BioLiP]