Structure of PDB 8xsz Chain Sa

Receptor sequence

>8xszSa (length=102) Species: 9606 (Homo sapiens)

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
RP

3D structure

• PDB: 8xsz Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: Sa
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Sa	T2 K3 K4 R5 R6 N7 N8 G9 R10 A11 K13 G14 R15 G16 H17 K32 K34 K37 K38 F39 Y68 V75 S76 I79 H80 K82 V83 V84 R85 N86 R87 S88 R89 R92 R95 P97 P98 R100	T1 K2 K3 R4 R5 N6 N7 G8 R9 A10 K12 G13 R14 G15 H16 K31 K33 K36 K37 F38 Y67 V74 S75 I78 H79 K81 V82 V83 R84 N85 R86 S87 R88 R91 R94 P96 P97 R99

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0045296 cadherin binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0033119 negative regulation of RNA splicing

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005791 rough endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0016020 membrane
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0045202 synapse
• GO:0070062 extracellular exosome
• GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8xsz, PDBe:8xsz, PDBj:8xsz
• PDBsum: 8xsz
• PubMed: 38942792
• UniProt: P62854|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)