Structure of PDB 8xsx Chain Sa

Receptor sequence
>8xsxSa (length=102) Species: 9606 (Homo sapiens) [Search protein sequence]
TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
RP
3D structure
PDB8xsx Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainSa
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0045296 cadherin binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0033119 negative regulation of RNA splicing
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8xsx, PDBe:8xsx, PDBj:8xsx
PDBsum8xsx
PubMed38942792
UniProtP62854|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)

[Back to BioLiP]