Structure of PDB 8oo0 Chain Sa

Receptor sequence
>8oo0Sa (length=104) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence]
VKKRKNNGRNKKGRGHVKPIRCSNCARCTPKDKAIKRFTIRNMVESAAIR
DISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRV
RYNK
3D structure
PDB8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
ChainSa
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sa V2 K3 K4 R5 K6 N7 R10 K13 R15 H17 K19 K32 K34 R38 F39 K70 V75 I79 H80 R85 R87 S88 R89 R92 R93 R95 R100 V1 K2 K3 R4 K5 N6 R9 K12 R14 H16 K18 K31 K33 R37 F38 K69 V74 I78 H79 R84 R86 S87 R88 R91 R92 R94 R99
BS02 ZN Sa C23 C26 C77 C22 C25 C76
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum8oo0
PubMed38267453
UniProtG0S2X4

[Back to BioLiP]