Structure of PDB 7qgg Chain Sa

Receptor sequence

>7qggSa (length=103) Species: 10116 (Rattus norvegicus) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
RPA

3D structure

PDB

7qgg Neuronal RNA granules are ribosome complexes stalled at the pre-translocation state.

Chain

Resolution

2.86 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Sa	T2 K3 K4 R5 R6 N7 N8 G9 R10 A11 K13 G14 R15 G16 H17 Q19 R28 K32 K34 K37 F39 K70 V75 S76 I79 K82 V84 R85 N86 R87 S88 R89 R92 R95 P97 P98 R100	T1 K2 K3 R4 R5 N6 N7 G8 R9 A10 K12 G13 R14 G15 H16 Q18 R27 K31 K33 K36 F38 K69 V74 S75 I78 K81 V83 R84 N85 R86 S87 R88 R91 R94 P96 P97 R99
BS02	rna	Sa	R42 H80	R41 H79
BS03	ZN	Sa	C23 C74 C77	C22 C73 C76

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0033119	negative regulation of RNA splicing

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links