Structure of PDB 7old Chain Sa

Receptor sequence
>7oldSa (length=104) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]
VKKRKNNGRNKKGRGHVKPIRCSNCARCTPKDKAIKRFTIRNMVESAAIR
DISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRV
RYNK
3D structure
PDB7old High-resolution structures of a thermophilic eukaryotic 80S ribosome reveal atomistic details of translocation.
ChainSa
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sa V2 K4 R5 K6 N8 R10 N11 K12 R15 G16 H17 K34 K37 R38 F39 K70 V75 S76 I79 H80 K82 R85 R87 S88 R89 R92 R93 R95 P98 V1 K3 R4 K5 N7 R9 N10 K11 R14 G15 H16 K33 K36 R37 F38 K69 V74 S75 I78 H79 K81 R84 R86 S87 R88 R91 R92 R94 P97
BS02 ZN Sa C26 C77 C25 C76
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7old, PDBe:7old, PDBj:7old
PDBsum7old
PubMed35079002
UniProtG0S2X4

[Back to BioLiP]