Structure of PDB 7olc Chain Sa

Receptor sequence
>7olcSa (length=104) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]
VKKRKNNGRNKKGRGHVKPIRCSNCARCTPKDKAIKRFTIRNMVESAAIR
DISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRV
RYNK
3D structure
PDB7olc High-resolution structures of a thermophilic eukaryotic 80S ribosome reveal atomistic details of translocation.
ChainSa
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sa V2 K3 K4 R5 K6 N7 R10 K13 G14 R15 G16 H17 K19 K32 K34 K37 R38 F39 K70 V75 S76 I79 H80 R85 R87 S88 R89 R92 R95 R100 V1 K2 K3 R4 K5 N6 R9 K12 G13 R14 G15 H16 K18 K31 K33 K36 R37 F38 K69 V74 S75 I78 H79 R84 R86 S87 R88 R91 R94 R99
BS02 ZN Sa C26 C77 C25 C76
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7olc, PDBe:7olc, PDBj:7olc
PDBsum7olc
PubMed35079002
UniProtG0S2X4

[Back to BioLiP]