Structure of PDB 6zmo Chain Sa

Receptor sequence

>6zmoSa (length=102) Species: 9606 (Homo sapiens) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
RP

3D structure

PDB

6zmo Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Sa	T2 K3 K4 R5 R6 N7 N8 G9 R10 A11 K13 G14 R15 G16 H17 R28 K32 K34 K37 K38 F39 I41 Y68 K70 V75 S76 I79 H80 K82 V84 R85 N86 R87 S88 R89 R92 R95 P97 P98 R100	T1 K2 K3 R4 R5 N6 N7 G8 R9 A10 K12 G13 R14 G15 H16 R27 K31 K33 K36 K37 F38 I40 Y67 K69 V74 S75 I78 H79 K81 V83 R84 N85 R86 S87 R88 R91 R94 P96 P97 R99
BS02	ZN	Sa	C23 C26 C77	C22 C25 C76

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0045296	cadherin binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0033119	negative regulation of RNA splicing

	Cellular Component
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:0098556	cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6zmo, PDBe:6zmo, PDBj:6zmo
PDBsum	6zmo
PubMed	32680882
UniProt	P62854\|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)