Structure of PDB 6olf Chain Sa

Receptor sequence

>6olfSa (length=102) Species: 9606 (Homo sapiens)

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
RP

3D structure

• PDB: 6olf Structural basis for selective stalling of human ribosome nascent chain complexes by a drug-like molecule.
• Chain: Sa
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Sa	T2 K3 K4 R5 R6 N8 K13 G14 R15 G16 H17 Q19 K32 K34 K37 K38 F39 K70 V75 I79 H80 V83 V84 R85 N86 R87 S88 R89 R92 K93 R95 T96 P97 P98	T1 K2 K3 R4 R5 N7 K12 G13 R14 G15 H16 Q18 K31 K33 K36 K37 F38 K69 V74 I78 H79 V82 V83 R84 N85 R86 S87 R88 R91 K92 R94 T95 P96 P97
BS02	ZN	Sa	C23 C74 C77	C22 C73 C76

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:6olf, PDBe:6olf, PDBj:6olf
• PDBsum: 6olf
• PubMed: 31160784
• UniProt: P62854|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)