Structure of PDB 3j7r Chain Sa

Receptor sequence

>3j7rSa (length=98) Species: 9823 (Sus scrofa) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPP

3D structure

PDB

3j7r Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Sa	T2 K3 K4 R5 R6 N7 N8 G9 R10 K12 K13 G14 R15 G16 H17 R28 K32 K34 K37 K38 F39 I41 K70 V75 I79 K82 V84 R85 N86 R87 S88 R92 R95 P97 P98 P99	T1 K2 K3 R4 R5 N6 N7 G8 R9 K11 K12 G13 R14 G15 H16 R27 K31 K33 K36 K37 F38 I40 K69 V74 I78 K81 V83 R84 N85 R86 S87 R91 R94 P96 P97 P98
BS02	ZN	Sa	C23 C26 C74 C77	C22 C25 C73 C76

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0098556	cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j7r, PDBe:3j7r, PDBj:3j7r
PDBsum	3j7r
PubMed	24930395
UniProt	P49171\|RS26_PIG Small ribosomal subunit protein eS26 (Gene Name=RPS26)