Structure of PDB 8tpu Chain SZ |
>8tpuSZ (length=72) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] |
IYIPRKCSATSRLIPAKEHGAVQINVGMVDANGVYNGKTETFAISGHVRQ NGESDACLNRLMYEKKLLSFQN |
|
PDB | 8tpu Divergent translational landscape reflects adaptation to biased codon usage in malaria parasites |
Chain | SZ |
Resolution | 4.1 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
SZ |
R22 E28 G56 H57 |
R12 E18 G46 H47 |
|
|
|