Structure of PDB 8ovj Chain SZ

Receptor sequence

>8ovjSZ (length=127) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

FQKKKAEVCIRTSQFKVNKLLNRKQFIVEVNHPHWCGTVPTQLIRKKLAT
LYKVPDASQVSLFGFKTKFGGGKTTGFGLIYDDLASLKRFEPNYRKTRMG
FGKARLPARKSVKERRNRNKKLRGKAK

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SZ	K5 K6 A8 T14 S15 Q16 F17 W37 C38 G39 T40 T43 Y54 F67 T69 F71 G72 G73 R91 Y96 R100 K105 A106 R107 L108 R111 K115 E116 R118 N119 K123 R125 G126 K127 K129	K3 K4 A6 T12 S13 Q14 F15 W35 C36 G37 T38 T41 Y52 F65 T67 F69 G70 G71 R89 Y94 R98 K103 A104 R105 L106 R109 K113 E114 R116 N117 K121 R123 G124 K125 K127

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

External links