Structure of PDB 6z6j Chain SZ

Receptor sequence
>6z6jSZ (length=69) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
QHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGGSLARIALRHLEKE
GIIKPISKHSKQAIYTRAT
3D structure
PDB6z6j Structure and function of yeast Lso2 and human CCDC124 bound to hibernating ribosomes.
ChainSZ
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SZ H38 G72 S74 R77 K94 H95 S96 H2 G36 S38 R41 K58 H59 S60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6z6j, PDBe:6z6j, PDBj:6z6j
PDBsum6z6j
PubMed32687489
UniProtQ3E792|RS25A_YEAST Small ribosomal subunit protein eS25A (Gene Name=RPS25A)

[Back to BioLiP]