Structure of PDB 6t7i Chain SZ

Receptor sequence
>6t7iSZ (length=82) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KKKWSKKSMKDRAQHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGG
SLARIALRHLEKEGIIKPISKHSKQAIYTRAT
3D structure
PDB6t7i Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
ChainSZ
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SZ W27 R35 G73 S74 R77 R81 K94 H95 S96 K97 W4 R12 G50 S51 R54 R58 K71 H72 S73 K74
BS02 rna SZ K25 W27 K2 W4
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t7i, PDBe:6t7i, PDBj:6t7i
PDBsum6t7i
PubMed31858614
UniProtQ3E792|RS25A_YEAST Small ribosomal subunit protein eS25A (Gene Name=RPS25A)

[Back to BioLiP]