Structure of PDB 7wtn Chain SY

Receptor sequence

>7wtnSY (length=134) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAE
KDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVE
KASRQQRKQKKNRDKKIFGTGKRLAKKVARRNAD

3D structure

PDB

7wtn The nucleoplasmic phase of pre-40S formation prior to nuclear export.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SY	R8 T9 R10 K11 S14 K21 A33 N34 V35 K37 Y48 F58 F60 R61 T62 F64 G66 Y89 R93 R105 Q106 K109 K112 N113 K116 K117 G120 T121 R124 K127 R131 R132	R7 T8 R9 K10 S13 K20 A32 N33 V34 K36 Y47 F57 F59 R60 T61 F63 G65 Y88 R92 R104 Q105 K108 K111 N112 K115 K116 G119 T120 R123 K126 R130 R131

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7wtn, PDBe:7wtn, PDBj:7wtn
PDBsum	7wtn
PubMed	36321656
UniProt	P0CX31\|RS24A_YEAST Small ribosomal subunit protein eS24A (Gene Name=RPS24A)