Structure of PDB 7mq9 Chain SY

Receptor sequence
>7mq9SY (length=238) Species: 9606 (Homo sapiens) [Search protein sequence]
MAAAFRKAAKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEY
LKALRKKALEKNPDEFYYKMTRVKLQDGVHIIKETKEEVTPEQLKLMRTQ
DVKYIEMKRVAEAKKIERLKSELHLLQNKHVFFFDTKKEVEQFDVATHLQ
TAPELVDRVFNRPRIETLQQTGLKRIAKERQKQYNCLTQRIEREKKLFVI
AQKIQTRKDLMDKTQKVKVKKETVNSPAIYKFQSRRKR
3D structure
PDB7mq9 Nucleolar maturation of the human small subunit processome.
ChainSY
Resolution3.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SY Y67 K228 Q230 K231 K236 Y245 K246 S249 Y67 K213 Q215 K216 K221 Y230 K231 S234
BS02 rna SY M1 A3 A4 R12 Q13 R14 E15 H16 R17 R19 K33 Y37 K38 Y44 R45 M1 A3 A4 R12 Q13 R14 E15 H16 R17 R19 K33 Y37 K38 Y44 R45
BS03 rna SY Y68 R72 K103 K114 Y68 R72 K103 K114
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0006364 rRNA processing
GO:0007399 nervous system development
GO:0042274 ribosomal small subunit biogenesis
GO:0043065 positive regulation of apoptotic process
Cellular Component
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0032040 small-subunit processome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7mq9, PDBe:7mq9, PDBj:7mq9
PDBsum7mq9
PubMed34516797
UniProtQ9Y3A2|UTP11_HUMAN Probable U3 small nucleolar RNA-associated protein 11 (Gene Name=UTP11)

[Back to BioLiP]