Structure of PDB 6ke6 Chain SY

Receptor sequence
>6ke6SY (length=103) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
PFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDG
CLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKE
KPR
3D structure
PDB6ke6 3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
ChainSY
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SY P42 S47 H48 K62 Q63 P64 N65 G106 K126 S131 K139 P1 S6 H7 K21 Q22 P23 N24 G65 K85 S90 K98
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
GO:0006450 regulation of translational fidelity
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ke6, PDBe:6ke6, PDBj:6ke6
PDBsum6ke6
PubMed
UniProtP0CX29|RS23A_YEAST Small ribosomal subunit protein uS12A (Gene Name=RPS23A)

[Back to BioLiP]