Structure of PDB 8ovj Chain SX

Receptor sequence

>8ovjSX (length=152) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

NKIHRIGKRKGATLKDVSAWRWIKTAARHFKQEGKIFVPNCTEIMKSSHG
RERAPQNPDWYYIRCAAVLRAIYLRPGVGYGGLSKRFGNKKNYGSRPEHT
VTSSTGPLHWACKSLTKLGLVEPGAQSGQRLTRKGHKFADSLAFQVQIRK
FG

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SX	N6 K7 I8 R10 G12 K13 R14 K15 G16 A17 W25 R26 K29 P44 N45 C46 M50 K51 H54 R56 E57 R58 P60 Q61 R69 R75 R80 G84 Y85 G87 K90 R91 K95 K96 G99 S100 R101 P102 H104 T105 S109 H114 K118 S132 Q134 R138 D145 I153 R154 K155 F156	N1 K2 I3 R5 G7 K8 R9 K10 G11 A12 W20 R21 K24 P39 N40 C41 M45 K46 H49 R51 E52 R53 P55 Q56 R64 R70 R75 G79 Y80 G82 K85 R86 K90 K91 G94 S95 R96 P97 H99 T100 S104 H109 K113 S127 Q129 R133 D140 I148 R149 K150 F151
BS02	MG	SX	N97 G99	N92 G94

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum	8ovj
PubMed	38722744
UniProt	E9AEE8

[Back to BioLiP]