Structure of PDB 3j7r Chain SX

Receptor sequence

>3j7rSX (length=141) Species: 9823 (Sus scrofa) [Search protein sequence]

GKCRGLRTARKLRSHRRDHKWHDKQYKKAHLGTALKANPFGGASHAKGIV
LEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVL
VAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPR

3D structure

PDB

3j7r Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SX	G2 K3 C4 R5 G6 L7 R8 R11 R14 R17 R18 H20 W22 H23 D24 K25 T34 K37 A38 S45 H46 A59 K60 Q61 S64 R67 K68 N87 D88 G89 R107 K108 H110 V112 G113 P116 R119 Y134	G1 K2 C3 R4 G5 L6 R7 R10 R13 R16 R17 H19 W21 H22 D23 K24 T33 K36 A37 S44 H45 A58 K59 Q60 S63 R66 K67 N86 D87 G88 R106 K107 H109 V111 G112 P115 R118 Y133

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:0098556	cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j7r, PDBe:3j7r, PDBj:3j7r
PDBsum	3j7r
PubMed	24930395
UniProt	Q6SA96\|RS23_PIG Small ribosomal subunit protein uS12 (Gene Name=RPS23)