Structure of PDB 6zu5 Chain SW0

Receptor sequence

>6zu5SW0 (length=127) Species: 235221 (Paranosema locustae)

MNRLAATCKAINNANRSGKRQVLIRFVTKTTRKFLEKMQVCGYISTLTYI
DDHRQGKVIIGLNGRLNKCGAICPNYCLTLKDVEKFKDKILPARQFGHLI
LNTSKGMIDHNECVTMKSGGEVLGFFY

3D structure

• PDB: 6zu5 Differences in structure and hibernation mechanism highlight diversification of the microsporidian ribosome.
• Chain: SW0
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SW0	M1 R3 A6 K9 N13 R25 T28 K29 R54 Q55 K68 A71 I72 C73 Y76 C77 T79 L80 K85 K89 I90 N102 S104 K105 K117 G119 E121 Y127	M1 R3 A6 K9 N13 R25 T28 K29 R54 Q55 K68 A71 I72 C73 Y76 C77 T79 L80 K85 K89 I90 N102 S104 K105 K117 G119 E121 Y127

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Feb 23 04:21:13 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zu5', asym_id = 'SW0', title = 'Differences in structure and hibernation mechani...t diversification of the microsporidian ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zu5', asym_id='SW0', title='Differences in structure and hibernation mechani...t diversification of the microsporidian ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zu5', asym_id = 'SW0'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zu5', asym_id='SW0')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>