Structure of PDB 8xt2 Chain SW

Receptor sequence
>8xt2SW (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]
AKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRR
RQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC
3D structure
PDB8xt2 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainSW
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SW A2 K3 H4 D38 R42 K47 C49 R50 R52 Q53 Y57 R59 R62 Y64 N65 D82 A1 K2 H3 D37 R41 K46 C48 R49 R51 Q52 Y56 R58 R61 Y63 N64 D81
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xt2, PDBe:8xt2, PDBj:8xt2
PDBsum8xt2
PubMed38942792
UniProtP82921|RT21_HUMAN Small ribosomal subunit protein bS21m (Gene Name=MRPS21)

[Back to BioLiP]