Structure of PDB 8rxh Chain SW

Receptor sequence

>8rxhSW (length=115) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

KFTYRGLEIDPLLALSEEEFKALVHARARRNMNRHADRRPPVLLKRLREA
KKHVKVGEKPKAVKTHLRDVVITPEMVGSVVAIYNGHQFNAVEIKGEMIG
HYLGEFSMSYRPVLH

3D structure

PDB

8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.93 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SW	R25 H45 A46 R47 R49 R50 N51 R54 R58 R59 V62 K65 R66 K84 H86 R88 D89 Y104 N105 G106 H107 F109 Y122 G124 E125 S129 Y130 V133 H135	R5 H25 A26 R27 R29 R30 N31 R34 R38 R39 V42 K45 R46 K64 H66 R68 D69 Y84 N85 G86 H87 F89 Y102 G104 E105 S109 Y110 V113 H115

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links