Structure of PDB 8k82 Chain SW

Receptor sequence

>8k82SW (length=129) Species: 4932 (Saccharomyces cerevisiae)

TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFE
YIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGY
VILTTSAGIMDHEEARRKHVSGKILGFVY

3D structure

• PDB: 8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: SW
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SW	T2 R3 S4 A8 N12 N16 K22 R28 S30 S31 K32 H56 R57 S58 K60 K71 V74 I75 S76 R78 N80 K82 I83 K88 W89 T105 T106 S107 R118 K119 H120 S122 K124 Y130	T1 R2 S3 A7 N11 N15 K21 R27 S29 S30 K31 H55 R56 S57 K59 K70 V73 I74 S75 R77 N79 K81 I82 K87 W88 T104 T105 S106 R117 K118 H119 S121 K123 Y129

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k82, PDBe:8k82, PDBj:8k82
• PDBsum: 8k82
• PubMed: 38942792
• UniProt: P0C0W1|RS22A_YEAST Small ribosomal subunit protein uS8A (Gene Name=RPS22A)