Structure of PDB 8bsi Chain SW

Receptor sequence

>8bsiSW (length=138) Species: 5741 (Giardia intestinalis) [Search protein sequence]

SSVTRVPADVFINSFAAHLKNRGIIKCPAFTDYVKTGVSRQYAPRDADWF
YIKAASVIRHFYISGSHSIGVAGLARKYSSLQKGKTTPHHTKRASCKVIR
SIVSQFLGQKLLIAGERGRHISPNGRKMVEDFAEGLQK

3D structure

PDB

8bsi Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SW	V35 K36 T37 V39 R41 Q42 Y43 P45 R46 I53 K54 S57 G71 V72 G74 R77 S80 L82 Q83 K84 G85 K86 T87 T88 P89 H90 H91 T92 K93 S96 C97 K98 R101 R118 R120	V34 K35 T36 V38 R40 Q41 Y42 P44 R45 I52 K53 S56 G70 V71 G73 R76 S79 L81 Q82 K83 G84 K85 T86 T87 P88 H89 H90 T91 K92 S95 C96 K97 R100 R117 R119

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links