Structure of PDB 7wtm Chain SW

Receptor sequence
>7wtmSW (length=129) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFE
YIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGY
VILTTSAGIMDHEEARRKHVSGKILGFVY
3D structure
PDB7wtm In vitro structural maturation of an early stage pre-40S particle coupled with U3 snoRNA release and central pseudoknot formation.
ChainSW
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SW T2 R3 S4 N12 N16 R28 S31 K32 H56 R57 K71 V74 I75 S76 R78 N80 K82 I83 W89 T105 T106 S107 R118 K119 S122 K124 Y130 T1 R2 S3 N11 N15 R27 S30 K31 H55 R56 K70 V73 I74 S75 R77 N79 K81 I82 W88 T104 T105 S106 R117 K118 S121 K123 Y129
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wtm, PDBe:7wtm, PDBj:7wtm
PDBsum7wtm
PubMed36263816
UniProtP0C0W1|RS22A_YEAST Small ribosomal subunit protein uS8A (Gene Name=RPS22A)

[Back to BioLiP]