Structure of PDB 8fle Chain SV

Receptor sequence
>8fleSV (length=139) Species: 9606 (Homo sapiens) [Search protein sequence]
MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVR
WTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIK
QKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLA
3D structure
PDB8fle Principles of human pre-60S biogenesis
ChainSV
Resolution2.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SV G16 G18 M19 S34 K35 K38 K42 R44 R50 W51 K53 R56 K61 R111 N115 G16 G18 M19 S34 K35 K38 K42 R44 R50 W51 K53 R56 K61 R111 N115
BS02 ZN SV C6 C9 C36 C6 C9 C36
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fle, PDBe:8fle, PDBj:8fle
PDBsum8fle
PubMed37410842
UniProtQ9UHA3|RLP24_HUMAN Probable ribosome biogenesis protein RLP24 (Gene Name=RSL24D1)

[Back to BioLiP]