Structure of PDB 8y0u Chain SU

Receptor sequence
>8y0uSU (length=100) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
IKIRITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTRK
TPNGEGSKTWETYEMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEVVVA
3D structure
PDB8y0u dormant ribosome with STM1
ChainSU
Resolution3.59 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SU E35 G54 R57 L58 P59 S66 T70 P71 N72 G73 E74 S76 K77 T78 W79 R85 H87 E16 G35 R38 L39 P40 S47 T51 P52 N53 G54 E55 S57 K58 T59 W60 R66 H68
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y0u, PDBe:8y0u, PDBj:8y0u
PDBsum8y0u
PubMed38698775
UniProtP38701|RS20_YEAST Small ribosomal subunit protein uS10 (Gene Name=RPS20)

[Back to BioLiP]