Structure of PDB 6t7t Chain SU

Receptor sequence
>6t7tSU (length=100) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
IKIRITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTRK
TPNGEGSKTWETYEMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEVVVA
3D structure
PDB6t7t Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
ChainSU
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SU R23 K53 G54 V56 R57 L58 P59 T60 T67 K69 P71 N72 G73 E74 G75 S76 K77 T78 W79 R85 H87 K88 R89 Y90 R4 K34 G35 V37 R38 L39 P40 T41 T48 K50 P52 N53 G54 E55 G56 S57 K58 T59 W60 R66 H68 K69 R70 Y71
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t7t, PDBe:6t7t, PDBj:6t7t
PDBsum6t7t
PubMed31858614
UniProtP38701|RS20_YEAST Small ribosomal subunit protein uS10 (Gene Name=RPS20)

[Back to BioLiP]