Structure of PDB 3j7r Chain SU

Receptor sequence
>3j7rSU (length=104) Species: 9823 (Sus scrofa) [Search protein sequence]
AIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITT
RKTPCGEGSKTWDRFQMRIPKRLIDLHSPSEIVKQITSISIEPGVEVEVT
IADA
3D structure
PDB3j7r Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.
ChainSU
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SU R21 E33 K51 G52 V54 R55 M56 P57 T58 K59 T60 K67 T68 P69 C70 G71 E72 G73 S74 K75 T76 W77 R79 R83 P85 K86 R87 L88 R6 E18 K36 G37 V39 R40 M41 P42 T43 K44 T45 K52 T53 P54 C55 G56 E57 G58 S59 K60 T61 W62 R64 R68 P70 K71 R72 L73
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j7r, PDBe:3j7r, PDBj:3j7r
PDBsum3j7r
PubMed24930395
UniProtA1XQU9|RS20_PIG Small ribosomal subunit protein uS10 (Gene Name=RPS20)

[Back to BioLiP]