Structure of PDB 8k82 Chain ST

Receptor sequence

>8k82ST (length=143) Species: 4932 (Saccharomyces cerevisiae)

PGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAE
GWFYKRAASVARHIYMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSIN
RKVLQALEKIGIVEISPKGGRRISENGQRDLDRIAAQTLEEDE

3D structure

• PDB: 8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: ST
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	ST	R7 Q12 I15 K38 N43 E44 M45 P47 Q48 R57 S60 R63 H64 R68 K69 G72 V73 G74 K75 K78 L79 K84 R86 G87 V88 R89 P90 Y91 K92 H93 S97 G98 S99 R102 R122 E126 Q129 R130 D133	R6 Q11 I14 K37 N42 E43 M44 P46 Q47 R56 S59 R62 H63 R67 K68 G71 V72 G73 K74 K77 L78 K83 R85 G86 V87 R88 P89 Y90 K91 H92 S96 G97 S98 R101 R121 E125 Q128 R129 D132

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0000054 ribosomal subunit export from nucleus
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k82, PDBe:8k82, PDBj:8k82
• PDBsum: 8k82
• PubMed: 38942792
• UniProt: P07280|RS19A_YEAST Small ribosomal subunit protein eS19A (Gene Name=RPS19A)