Structure of PDB 8fkt Chain ST

Receptor sequence
>8fktST (length=116) Species: 9606 (Homo sapiens) [Search protein sequence]
WLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAA
GLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVKKRKFQPLFGD
FAAEKKNQLELLRVMN
3D structure
PDB8fkt Principles of human pre-60 S biogenesis.
ChainST
Resolution2.81 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna ST K251 F254 F258 K91 F94 F98
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008097 5S rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002244 hematopoietic progenitor cell differentiation
GO:0007080 mitotic metaphase chromosome alignment
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
GO:1901796 regulation of signal transduction by p53 class mediator
GO:1902570 protein localization to nucleolus
Cellular Component
GO:0000794 condensed nuclear chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005783 endoplasmic reticulum
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fkt, PDBe:8fkt, PDBj:8fkt
PDBsum8fkt
PubMed37410842
UniProtQ15050|RRS1_HUMAN Ribosome biogenesis regulatory protein homolog (Gene Name=RRS1)

[Back to BioLiP]