Structure of PDB 7cpu Chain ST

Receptor sequence

>7cpuST (length=140) Species: 10090 (Mus musculus) [Search protein sequence]

GVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENW
FYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARR
VLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAAN

3D structure

PDB

7cpu A male germ-cell-specific ribosome controls male fertility.

Chain

Resolution

2.82 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	ST	G3 V4 Q11 Q12 R16 W33 K38 K41 K43 E44 L45 P47 Y48 R56 S59 R62 H63 L66 R67 G71 V72 G73 S74 K77 I78 R82 R84 G86 V87 R88 P89 H91 F92 S96 K97 S98 R101 Q105 G119 G120 R121 P125 Q128 R129 D132	G1 V2 Q9 Q10 R14 W31 K36 K39 K41 E42 L43 P45 Y46 R54 S57 R60 H61 L64 R65 G69 V70 G71 S72 K75 I76 R80 R82 G84 V85 R86 P87 H89 F90 S94 K95 S96 R99 Q103 G117 G118 R119 P123 Q126 R127 D130

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0007219	Notch signaling pathway
GO:0030218	erythrocyte differentiation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:0045202	synapse
GO:0098794	postsynapse
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7cpu, PDBe:7cpu, PDBj:7cpu
PDBsum	7cpu
PubMed	36517592
UniProt	Q9CZX8\|RS19_MOUSE Small ribosomal subunit protein eS19 (Gene Name=Rps19)